General Information

  • ID:  hor006004
  • Uniprot ID:  P83059
  • Protein name:  bradykinin
  • Gene name:  NA
  • Organism:  Bombina orientalis (Oriental fire-bellied toad)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0045776 negative regulation of blood pressure; GO:0045987 positive regulation of smooth muscle contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RRPPGFTPFR
  • Length:  10
  • Propeptide:  MRLWFCLSFFVVLCLEHFPGTLADERNNRDYPIRTHLHGPHIPRNNRDYPIRTHLHGHHIPRNVPESEEKTEQFLRDLSEISRLQRRPPGFTPFRGKFHSQSLRDLSEISRLQRRPPGFTPFRGKFHSQSLRDMYEIKGFKSAHGRPRVCPPGEQCPIWVG
  • Signal peptide:  MRLWFCLSFFVVLCLEHFPGTLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [[Thr6]-bradykinin]: Inhibits ACE with a Ki of 1.6 uM, and targets B2 bradykinin receptor (BDKRB2). Provokes contraction of smooth muscle preparation (ileum). In vivo, induces an early hyperalgesic effects in living rats after intraplantar injection (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83059-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006004_AF2.pdbhor006004_ESM.pdb

Physical Information

Mass: 139112 Formula: C57H87N19O12
Absent amino acids: ACDEHIKLMNQSVWY Common amino acids: PR
pI: 12.8 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -138 Boman Index: -4043
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 12406 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12217414
  • Title:  Bradykinins and their precursor cDNAs from the skin of the fire-bellied toad (Bombina orientalis).
  • PubMed ID:  20138946
  • Title:  Peptide DV-28 amide: An inhibitor of bradykinin-induced arterial smooth muscle relaxation encoded by Bombina orientalis skin kininogen-2.